• Register
  • Login
  • English
    • 中文
Advanced Search
  • Home
  • Chemistry
    • Asymmetric Synthesis(4276)
      • Chiral Auxiliaries (3251)
      • Chiral Building Blocks (591)
      • Chiral Catalysts, Chiral Ligands and Chiral Reagents (67)
      • Chiral Resolution Reagents (206)
      • Chiral Catalyst, Ligand and Reagent (144)
      • Resolution Reagents (17)
    • Biochemical Reagents(1771)
      • Biochemical Assay Reagent (89)
      • Dye Reagent (49)
      • Intermidate and Others (144)
      • Nucleosides, Nucleotides, Oligonucleotides (54)
      • Proteins and Derivatives (66)
      • Biological Buffer (200)
      • Fluorescent Probe and Stain (59)
      • Enzymes and Coenzymes (224)
      • Luminescent Compound (131)
      • Carbohydrate (121)
      • more
    • Catalysis Chemistry(12162)
      • C-H Activation (181)
      • Carbon-Donor Ligands (69)
      • Cross-Coupling (169)
      • Cross-Coupling using Transition Metal Catalysts (189)
      • Diketone Ligands (135)
      • Hydrogenation (130)
      • Main-Group Elements (129)
      • Metal Catalysts (372)
      • Nitrogen-Donor Ligands (156)
      • Non-Precious Metal Catalysts (205)
      • more
    • Chemical Biology(2021)
      • Conjugation Chemistry (88)
      • Glycoscience (197)
      • Linkers and Crosslinkers (209)
      • Nucleic Acid Chemistry (199)
      • PEGylation (96)
      • Peptide Chemistry (45)
      • Photolabile Protecting Group (234)
      • Amino Acid Derivatives (165)
      • Solid Phase Peptide Synthesis (SPPS) (98)
      • Peptide Synthesis (178)
      • more
    • Heterocyclic Building Blocks(23407)
      • Acridines (94)
      • Aliphatic Heterocycles (182)
      • Pyridazines (256)
      • Aromatic Heterocycles (179)
      • Pyridines (3437)
      • Azetidines (200)
      • Pyrimidines (906)
      • Benzimidazoles (218)
      • Pyrroles (267)
      • Benzisoxazoles (238)
      • more
    • Organic Building Blocks(21678)
      • Acyl Chlorides (206)
      • Alcohols (370)
      • Aldehydes (187)
      • Aliphatic Chain Hydrocarbons (260)
      • Aliphatic Cyclic Hydrocarbons (269)
      • Aliphatic Hydrocarbons (153)
      • Alkenyls (524)
      • Alkyls (89)
      • Alkynyls (326)
      • Amides (209)
      • more
    • Organometallic Reagents(2663)
      • Grignard Reagents (195)
      • Organoarsenic (194)
      • Organobismuth (98)
      • Organoboron (529)
      • Organogermanium (174)
      • Organolithium (225)
      • Organomercury (137)
      • Organometallic Reagent (93)
      • Organosilicon (247)
      • Organotin (30)
      • more
    • Specialty Synthesis(324)
      • Enzyme-Mediated Synthesis (53)
      • Fluorous Synthesis (67)
      • Ionic Liquids (134)
      • Solid Supported Synthesis (70)
    • Stains and Dyes(1774)
      • Acid Dyes (143)
      • Azoic Dyes (166)
      • Basic Dyes (42)
      • Direct Dyes (213)
      • Disperse Dyes (203)
      • Dye Intermediates (65)
      • Mordant Dyes (184)
      • Oil Dyes (152)
      • Other Stains and Dyes (212)
      • Pigments (157)
      • more
    • Synthetic Reagents(5133)
      • Acids & Bases (93)
      • C-C Bond Formation (147)
      • C-X Bond Formation (146)
      • Chelation and Complexation Compounds (195)
      • Condensation Agents (52)
      • Coupling (126)
      • Dehydrating Reagents (116)
      • Fluorination Reagents (148)
      • Halogenation Reagents (152)
      • Oxidant (110)
      • more
    • more
  • Pharmaceutical Intermediates
    • Analgesics(1337)
      • Benzhydrocodone (221)
      • Bicifadine (190)
      • Debio-0827 (205)
      • Parecoxib (234)
      • Pregnanolone (246)
      • Spiradoline (63)
      • Tapentadol (97)
      • Zucapsaicin related (81)
    • Anesthetics(827)
      • Fospropofol (197)
      • Levobupivacaine (228)
      • Remimazolam (261)
      • Remimazolam besylate (90)
      • Ropivacaine (51)
    • Anti-Addiction Agents(301)
      • Kakonein (114)
      • Varenicline (187)
    • Anti-inflammatory Agents(2450)
      • ATB-346 related (73)
      • Balsalazide (68)
      • Celecoxib related (151)
      • Dilmapimod (172)
      • Esflurbiprofen (154)
      • Etoricoxib (184)
      • Filgotinib related (21)
      • Flobufen (197)
      • Grapiprant related (85)
      • GW-406381 (138)
      • more
    • Antibacterials(6470)
      • AFN-1252 related (278)
      • Alatrofloxacin (83)
      • Besifloxacin (94)
      • Brilacidin (262)
      • Cefilavancin (73)
      • Ceftaroline Fosamil (272)
      • Ceftizoxime alapivoxil (87)
      • Cethromycin related (72)
      • Daptomycin related (146)
      • Delafloxacin related (230)
      • more
    • Anticonvulsants(1801)
      • Brivaracetam (86)
      • Eslicarbazepine Acetate related (225)
      • Gabapentin Enacarbil (66)
      • JNJ-10234094 (207)
      • Levetiracetam related (55)
      • Losigamone (89)
      • Naluzotan (150)
      • Perampanel (71)
      • Pregabalin (192)
      • Remacemide (93)
      • more
    • Antidementia Agents(1495)
      • Azeliragon related (92)
      • Davunetide (61)
      • Donepezil related (135)
      • Ensaculin (72)
      • Idalopirdine (223)
      • Lanabecestat (118)
      • NTC-942 (67)
      • SB 742457 (164)
      • Semagacestat related (82)
      • T-807 (95)
      • more
    • Antidepressants(3594)
      • 4-Chlorokynurenine (170)
      • Agomelatine related (121)
      • Allopregnanolone related (195)
      • Amibegron (229)
      • Amitifadine (72)
      • Aripiprazole related (200)
      • Basimglurant (13)
      • Befloxatone (227)
      • Befuraline (225)
      • Desvenlafaxine related (254)
      • more
    • Antiemetics(876)
      • Aprepitant related (52)
      • Dolasetron related (202)
      • Fosaprepitant related (194)
      • Palonosetron related (217)
      • Rolapitant related (211)
    • Antifungals(2035)
      • Anidulafungin related (91)
      • Caspofungin (192)
      • Eberconazole (135)
      • Efinaconazole related (64)
      • G1 (173)
      • Isavuconazonium Sulfate related (152)
      • Luliconazole related (88)
      • Micafungin related (164)
      • MK 3118 (117)
      • Posaconazole related (201)
      • more
    • more
  • Inhibitors/Agonists
    • Anti-infection(3382)
      • Arenavirus (214)
      • Bacterial (799)
      • CMV (59)
      • Enterovirus (197)
      • Filovirus (130)
      • Fungal (230)
      • HBV (95)
      • HCV (186)
      • HIV (266)
      • HSV (163)
      • more
    • Antibody-drug Conjugate/ADC Related(524)
      • ADC Cytotoxin (119)
      • ADC Linker (183)
      • Drug-Linker Conjugates for ADC (178)
      • PROTAC-linker Conjugate for PAC (44)
    • Apoptosis(2116)
      • Apoptosis (525)
      • Bcl-2 Family (165)
      • c-Myc (179)
      • Caspase (246)
      • DAPK (125)
      • Ferroptosis (153)
      • FKBP (83)
      • IAP (174)
      • MDM-2/p53 (57)
      • PKD (71)
      • more
    • Autophagy(1077)
      • Autophagy (350)
      • FKBP (162)
      • LRRK2 (156)
      • Mitophagy (205)
      • ULK (204)
    • Cell Cycle/DNA Damage(4886)
      • Antifolate (85)
      • APC (123)
      • ATM/ATR (111)
      • Aurora Kinase (75)
      • Casein Kinase (43)
      • CDK (217)
      • Checkpoint Kinase (Chk) (98)
      • CRISPR/Cas9 (38)
      • Deubiquitinase (136)
      • DNA Alkylator/Crosslinker (127)
      • more
    • Cytoskeleton(1248)
      • Arp2/3 Complex (123)
      • Dynamin (215)
      • Gap Junction Protein (74)
      • Integrin (160)
      • Kinesin (135)
      • Microtubule/Tubulin (176)
      • Mps1 (176)
      • Myosin (164)
      • PAK (25)
    • Epigenetics(2117)
      • AMPK (196)
      • Aurora Kinase (191)
      • DNA Methyltransferase (46)
      • Epigenetic Reader Domain (199)
      • HDAC (90)
      • Histone Acetyltransferase (117)
      • Histone Demethylase (212)
      • Histone Methyltransferase (192)
      • JAK (237)
      • MicroRNA (93)
      • more
    • GPCR/G Protein(8036)
      • 5-HT Receptor (308)
      • Adenosine Receptor (165)
      • Adenylate Cyclase (44)
      • Adiponectin Receptor (87)
      • Adrenergic Receptor (216)
      • Angiotensin Receptor (174)
      • Bombesin Receptor (154)
      • Bradykinin Receptor (209)
      • Cannabinoid Receptor (151)
      • CaSR (162)
      • more
    • Immunology/Inflammation(3917)
      • Arginase (215)
      • Aryl Hydrocarbon Receptor (177)
      • CCR (65)
      • CD73 (159)
      • Complement System (183)
      • COX (198)
      • CXCR (97)
      • FKBP (253)
      • FLAP (178)
      • Galectin (71)
      • more
    • JAK/STAT Signaling(571)
      • EGFR (145)
      • JAK (46)
      • Pim (213)
      • STAT (167)
    • more
  • Materials Science
    • Electronic Material(1680)
      • Battery Materials (147)
      • Dye-Sensitized Solar Cell (DSSC) Materials (75)
      • Liquid Crystal (LC) Materials (175)
      • Molecular Conductors (201)
      • Organic Light-Emitting Diode (OLED) Materials (345)
      • Organic Solar Cell (OPV) Materials (274)
      • Organic Transistor (OFET) Materials (123)
      • Perovskite Solar Cell (PSC) Materials (169)
      • Self Assembly Materials (171)
    • Magnetic Materials(614)
      • Magnetic Ionic Liquids (271)
      • Magnetic Material (94)
      • Magnetic Metal Complexes (200)
      • Organic Radicals (49)
    • Material Building Blocks(1120)
      • Ligands for Functional Metal Complexes (58)
      • Liquid Crystal (80)
      • Phthalocyanine Building Blocks (212)
      • Polymer and Macromolecule Semiconductor Building Blocks (151)
      • Small Molecule Semiconductor Building Blocks (179)
      • Solubility Enhancing Reagents (163)
      • Supramolecular Host Materials (88)
      • Liquid Crystal (LC) Building Blocks (189)
    • Material Others(240)
      • Mateial Other (240)
    • Nanomaterials(1814)
      • Carbon Nanomaterials (64)
      • Ceramic Membranes (59)
      • Dendrimers (98)
      • Gold Nanoparticles (151)
      • Iron Oxide Nanoparticles (177)
      • Materials by Application (76)
      • Mesoporous Materials (175)
      • Metals&Metal Alloys (89)
      • Nano Minerals: Nanoclays (197)
      • Nanopowders & Nanoparticle Dispersions (72)
      • more
    • Optical Materials(1866)
      • Coumarin Dyes (166)
      • Cyanine and Squarylium Dyes (154)
      • DCM Dyes (85)
      • Dipyrromethene Dyes (60)
      • Fluorescence Materials (48)
      • Fluorescent Probes (79)
      • Heat and Pressure Sensitive Dyes (81)
      • Near-Infrared (215)
      • Organic Non-Linear Optical (156)
      • Other Functional Dyes (25)
      • more
    • Organic Pigments(373)
      • Organic Pigment (373)
    • Polymer Science(2241)
      • Monomers (203)
      • Polymer Additives (119)
      • Polymerization Reagents (195)
      • Polymers (279)
      • Resins (199)
      • Polymerization Initiator (204)
      • Engineering Plastic (36)
      • Plastic Additive (115)
      • Natural Polymer (211)
      • Hydrophilic Polymer (59)
      • more
    • Electronic Materials(0)
    • Metal and Ceramics science(973)
      • Alloy (75)
      • Salt (179)
      • Ceramics (265)
      • Chalcogenide Compounds (239)
      • Carbon-based Material (215)
    • more
  • Life Science
    • ADC-linkers(128)
      • ADC-linker (128)
    • Amino acids(2917)
      • Amino acid (150)
      • Amino acid derivatives (2767)
    • DNA/RNA(216)
      • Nucleosides & Nucleotides (216)
    • Enzyme(91)
      • Enzymes (91)
    • Others(932)
      • CRISPR/Cas9 (233)
      • eIF (247)
      • IRE1 (198)
      • Life Other (87)
      • Neuronal Signaling (74)
      • Sigma Receptor (93)
    • Peptides(171)
      • Peptide (171)
    • Standard Substrates(133)
      • Standard Substrate (133)
    • Steroids(0)
    • Cytokines(29)
      • Cytokines (29)
    • APIs(97)
      • API (97)
    • more
  • Analytical chromatography
    • Reference Materials(3282)
      • Gas Chromatography Reference Standard (177)
      • Agricultural and Environmental Reference Standard (244)
      • Inorganic Solution Reference Standard (146)
      • Chemicals (126)
      • Pesticides, Veterinary drugs (613)
    • Analytical Reagents(786)
    • Resin and LC separation medium(210)
    • Solvent(517)
    • High pressure liquid chromatography(95)
      • HPLC solvent (95)
    • Gas Chromatography(29)
    • Ion sensor materials(62)
  • Inhibitors/Agonists
  • Neuronal Signaling
  • Amyloid-β
  • ALZ-801
    98%      CAS No.:1034190-08-3
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R831470-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R831470-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R831470-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R831470-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R831470-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R831470-10mg In-Stock(Shanghai or CA Irwindale)
    -
    +
  • Inositol
    >98.0%      CAS No.:488-59-5
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R011816-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R011816-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R011816-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R011816-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R011816-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
  • β-Amyloid 1-20
    98%      CAS No.:186319-68-6
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R032813-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R032813-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R032813-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R032813-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R032813-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
  • L-alpha-Aspartyl-L-alanyl-L-alpha-glutamyl-L-phenylalanyl-L-arginyl-L-histidyl-L-alpha-aspartyl-L-serylglycyl-L-tyrosyl-L-alpha-glutamyl-L-valyl-L-histidyl-L-histidyl-L-glutamine
    98%      CAS No.:183745-81-5
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R633114-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R633114-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R633114-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R633114-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R633114-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
  • Aftin-4
    97%      CAS No.:866893-90-5
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R773878-25mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R773878-50mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R773878-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R773878-1mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R773878-5mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R773878-10mg In-Stock(Shanghai or CA Irwindale)
    -
    +
  • Azeliragon
    98+%      CAS No.:603148-36-3
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R716451-10mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R716451-25mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R716451-100mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R716451-250mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R716451-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
  • β-Amyloid 22-35
    98%      CAS No.:144189-71-9
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R603765-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R603765-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R603765-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R603765-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R603765-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R603765-1mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R603765-5mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R603765-10mg In-Stock(Shanghai or CA Irwindale)
    -
    +
  • Saikosaponin C
    HPLC≥98%      CAS No.:20736-08-7
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R032834-250mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R032834-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R032834-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R032834-20mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R032834-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
  • Schisantherin B
    98%      CAS No.:58546-55-7
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R263497-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R263497-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R263497-20mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R263497-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R263497-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R263497-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
  • 4-(6-Bromo-2-benzothiazolyl)benzenamine
    98%      CAS No.:566169-97-9
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R712506-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R712506-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R712506-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R712506-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R712506-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R712506-10mg In-Stock(Shanghai or CA Irwindale)
    -
    +
  • Amyloid β Peptide (42-1)(human) (AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD)
    98%      CAS No.:317366-82-8
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R671862-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R671862-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R671862-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R671862-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R671862-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R671862-1mg In-Stock(Shanghai or CA Irwindale)
    -
    +
  • 4-(6-Bromo-2-benzothiazolyl)-N-methylbenzenamine
    98.60%      CAS No.:566169-98-0
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R712507-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R712507-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R712507-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R712507-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R712507-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
  • Phenol, 2-[(2-pyridinylmethyl)amino]-
    99.57%      CAS No.:102212-26-0
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R523537-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
  • Notoginsenoside R1
    HPLC≥98%      CAS No.:80418-24-2
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R396388-1mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R396388-5mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R396388-10mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R396388-25mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R396388-50mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R396388-100mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R396388-250mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R396388-20mg In-Stock(Shanghai or CA Irwindale)
    -
    +
  • gamma-Secretase Modulators
    98%      CAS No.:937812-80-1
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R814324-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R814324-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R814324-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R814324-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R814324-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R814324-5mg In-Stock(Shanghai or CA Irwindale)
    -
    +
    R814324-10mg In-Stock(Shanghai or CA Irwindale)
    -
    +
  • Semilicoisoflavone B
    98%      CAS No.:129280-33-7
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R578531-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R578531-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R578531-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R578531-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R578531-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R578531-5mg In-Stock(Shanghai or CA Irwindale)
    -
    +
  • Amyloid b-Protein (29-40)
    98%      CAS No.:184865-04-1
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R633968-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R633968-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R633968-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R633968-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R633968-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
  • β-Amyloid (1-42), rat (Amyloid β-peptide (1-42) (rat))
    98%      CAS No.:166090-74-0
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R622204-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R622204-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R622204-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R622204-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R622204-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R622204-1mg In-Stock(Shanghai or CA Irwindale)
    -
    +
  • Glutaminyl Cyclase Inhibitor 2
    98%      CAS No.:1884546-29-5
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R910212-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R910212-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R910212-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R910212-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R910212-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
  • amyloid P-IN-1
    99.91%      CAS No.:1819986-22-5
    Price
  • SKU-Pack Size Availability Price($) Quantity
    R909951-1g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R909951-5g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R909951-10g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R909951-25g In-Stock(Shanghai or CA Irwindale)
    -
    +
    R909951-100g In-Stock(Shanghai or CA Irwindale)
    -
    +
  • <
  • 1
  • 2
  • 3
  • >

  • Terms & Conditions
  • Chemistry Services
  • About Us
  • Contact Us
CopyRight © 上海双锕化学科技有限 | 沪ICP备18013661号